Home » Trending » Mehandi Designs » 25 Best Marwari mehndi designs for hands & feet

25 Best Marwari mehndi designs for hands & feet




Every tradition or cultural has own style of lifestyle and what they lead the lifestyle maybe that is completely different in other communities. Similarly like our Indian culture is quite distinct and the traditions or customs are much followed by every Indian that is mandatory. We cannot forget our culture anymore as whatever we learn that is all our culture’s blessing. When it comes to take part in any cultural program first thing must be about your wearing style what you wear actually. Obviously on your cultural program you wear all traditional dresses that completely suit on you as well as another important thing that you can’t ignore that is mehndi this is great asset of every woman that they must follow the mehndi design for all occasions exactly. As we said above that every community has different livings style with diverse type of mehndi design they wear like Marwari is a community that has very exclusive and unique mehndi pattern. We will know more about Marwari mehndi motifs for hands and foot and those are:

1. Simple Marwari Mehndi Design:

This mehndi design is simple but more exquisite and provides complete ornamental detailing on your mehndi design. This simplest mehndi design is most common and opted by all women for any special program, and family functions. Try this mehndi design to enhance the gorgeousness of your personality.simplemarwarimehndidesignsforhands

 

2. Artistic Marwari Mehndi Design:

In such artistic mehndi motif that clearly features with spiral patterns and numbers of floral designs are quite less. It is looking tremendous and curves with spiral designs providing completely cute looks to your hands.marwari-mehndi-designs-10

 

3. Elegant Marwari Mehndi Design:

This stunning mehndi design is awesome and creates more attention. This mehndi design makes perfectness and loon modern appearance whereas, this mehndi pattern is designed with all unique flowers and leaves those are completely outstanding.rajasthani-mehndi-designs-for-eid-4

4.Plain Stylish Marwari Mehndi Design:

This mehndi design is giving very regal look to you and this amazing mehndi design is very sophisticated and providing very exquisite look to your whole figures. The design is simply weaved with flowers and leaves that gives a great symbol of simplicity and the design is till the wrist where the design brings very eye-catching moment.plain-stylish-marwari-mehndi-design

 

5. Chic Marwari Mehndi Design:

The entire mehndi designs are decorated with few thin lines and elaborate the great look and these lines providing more beautiful look. The lines and flowers are merged together creating extremely breathtaking features.chic-marwari-mehndi-design

6.High-Up Marwari Mehndi Design:

This is contemporary menhdi style that features with best and perfect themes cater tribal look to overall personality. For easy and simple Marwari mehndi design you can simply use this mehndi design that gives completely awesome and fully grand look.bifurcated-pattern-design-marwari-mehandi-designs

 

7. Bride And Groom Marwari Mehndi Design:

This mehndi design is really incredible in which the brides and grooms images are designed that is suitable pattern for wedding and engagement ceremony. Thus mehndi motif catchy and captivating making complete meaningful of this mehndi design.214

 

8.Exquisite Marwari Foot Mehndi Design:

Some of mehndi designs work best on foot and hands whereas, as same way this mehndi design is elegant and provides royal look to your hands and foot. This mehndi pattern is unique and outstanding that gives your foot and hands very creative appearances.

9.Hottest Marwari Mehndi Design With Stones Crafted:

Look at this mehndi design that is fully crafted with beautiful and sparkling stones on your palms. This mehndi motif is designed with colorful stones and it is the best choice for wedding functions when the brides apply this mehndi style looks so gorgeous.bridal-mehndi-designs

10.Elaborated Paisley Marwari Mehndi Design:

Paisley mehndi design is another great mehndi theme in Marwari community whereas; this paisley design is completely elaborated and provides such a elegant style. To get grand style and want to be seen special on the parties wear this paisley mehndi design.


11.


12.

13.


14


15

16

17

18

19

20num-214

21

22

23


24


25

 

Source: 1,2 ,3 ,4,5,6,7,8,9,10,11,12 ,13,14,15,16 ,17,18,19 ,20,21,22 ,23,24,25

Recommended Articles:

SHARE THIS STORY ON FACEBOOK




Article Name
25 Best Marwari mehndi designs for hands & feet
Author
Description
Marwari Mehndi design will look beautiful for hands and foot, also it is easy to make.It also popular for intricate patterns that look lovely on the bride hand.

Written by: Beatuy Epic

Beauty Epic is the beauty network that sets a new level of trust and honesty in beauty world. We are driven by a commitment to prove Beauty Epic is best for beauty and improve women's lives by covering daily breakthroughs in beauty, Lifestyle and Health.

About Us

Beauty Epic is the Beauty Network that sets a new level of trust and honesty in beauty info. We are driven by a commitment to improve women's lives by covering daily breakthroughs in beauty, Lifestyle and Health.